PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G041400.1
Common NamePHAVU_008G041400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 92aa    MW: 10148.6 Da    PI: 7.4781
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G041400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer83.91.8e-262580359
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                        +v++ eC++NhA+++Gg a DGC Ef+ps g+e t +a+ Ca CgCHRnFHRre + 
  Phvul.008G041400.1 25 NVQHGECQRNHAVHVGGLAQDGCMEFIPS-GAEETDEAMMCAGCGCHRNFHRREIHI 80
                        7899************************9.777899*****************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-172388IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.0E-252678IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.1992877IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.5E-222978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSRVILRTQP PRECPSSNML TIVRNVQHGE CQRNHAVHVG GLAQDGCMEF IPSGAEETDE  60
AMMCAGCGCH RNFHRREIHI HVVCHCPSRN G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139578.17e-62hypothetical protein PHAVU_008G041400g
SwissprotQ9LJW52e-23MIF2_ARATH; Mini zinc finger protein 2
TrEMBLV7B0Z48e-62V7B0Z4_PHAVU; Uncharacterized protein
STRINGGLYMA09G37310.13e-27(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.11e-24mini zinc finger 2